Your shopping cart is currently empty

Klotho-derived peptide 1 (KP1) (56-87), a peptide originating from the human Klotho protein, disrupts TGF-β signaling by binding to TGF-β receptor types 1 and 2 (TGFBR1 and TGFBR2; Kds = 1.41 and 14.6 µM, respectively). Preincubation with KP1 at a concentration of 10 µg/ml hinders the TGF-β-induced escalation of fibronectin and α-smooth muscle actin (α-SMA) levels in NRK-49F rat fibroblasts. Furthermore, in vivo studies reveal that KP1, administered at 1 mg/kg per day, preferentially accumulates in damaged kidneys, leading to significant reductions in serum creatinine and blood urea nitrogen levels, indicators of improved kidney function. Additionally, it decreases kidney fibrosis in mouse models of unilateral ureteral obstruction (UUO) and unilateral ischemia-reperfusion injury-induced renal fibrosis.


| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 500 μg | $97 | Inquiry | Inquiry | |
| 1 mg | $185 | Inquiry | Inquiry | |
| 5 mg | $580 | Inquiry | Inquiry | |
| 10 mg | $964 | Inquiry | Inquiry |
| Description | Klotho-derived peptide 1 (KP1) (56-87), a peptide originating from the human Klotho protein, disrupts TGF-β signaling by binding to TGF-β receptor types 1 and 2 (TGFBR1 and TGFBR2; Kds = 1.41 and 14.6 µM, respectively). Preincubation with KP1 at a concentration of 10 µg/ml hinders the TGF-β-induced escalation of fibronectin and α-smooth muscle actin (α-SMA) levels in NRK-49F rat fibroblasts. Furthermore, in vivo studies reveal that KP1, administered at 1 mg/kg per day, preferentially accumulates in damaged kidneys, leading to significant reductions in serum creatinine and blood urea nitrogen levels, indicators of improved kidney function. Additionally, it decreases kidney fibrosis in mouse models of unilateral ureteral obstruction (UUO) and unilateral ischemia-reperfusion injury-induced renal fibrosis. |
| Synonyms | KP1 (56-87) |
| Molecular Weight | 3228.44 |
| Formula | C149H203N39O43.XCF3COOH |
| Smiles | [H]N[C@H](C(N[C@@H](CCC(N)=O)C(NCC(N[C@]([C@@H](C)O)([H])C(N[C@H](C(N1CCC[C@H]1C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)CC2=CN=CN2)=O)=O)=O)CC3=CNC4=C3C=CC=C4)=O)=O)=O)=O)=O)=O)CC5=CC=C(O)C=C5)=O)C)=O)C)=O)=O)=O)=O)C)=O)CC6=CNC7=C6C=CC=C7)=O)=O)CC8=CC=CC=C8)=O)=O)CC(O)=O)=O)=O)CC9=CC=CC=C9)=O)=O)=O)=O)CC%10=CC=CC=C%10.FC(F)(C(O)=O)F |
| Sequence | Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly |
| Sequence Short | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.