Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

Klotho-derived Peptide 1 (56-87) (human) TFA

Name: Klotho-derived Peptide 1 (56-87) (human) TFA
Brand: TargetMol
SKU: T83770
Rating: 4.5 (1 reviews)

(Synonyms: KP1 (56-87) (human) TFA) Copy Product Info

🥰Excellent

Synonyms: KP1 (56-87) (human) TFA

Catalog No. T83770 Copy Product Info

🥰Excellent

Klotho-derived Peptide 1 (56-87) (human) TFA, a peptide derived from the human Klotho protein, disrupts TGF-β signaling through binding interactions with TGF-β receptor type 1 (TGFBR1) and TGF-β receptor type 2 (TGFBR2), with Kd values of 1.41 and 14.6 µM, respectively. Preincubation with Klotho-derived Peptide 1 (56-87) (human) TFA at 10 µg/mL inhibits TGF-β-induced increases in fibronectin and α-smooth muscle actin (α-SMA) expression in NRK-49F rat fibroblasts. In vivo investigations demonstrate that Klotho-derived Peptide 1 (56-87) (human) TFA, administered at 1 mg/kg per day, preferentially accumulates in damaged kidneys and significantly reduces serum creatinine and blood urea nitrogen levels while decreasing renal fibrosis in mouse models of unilateral ureteral obstruction (UUO) and unilateral ischemia-reperfusion injury-induced renal fibrosis. Klotho-derived Peptide 1 (56-87) (human) TFA is therefore valuable for investigations involving renal fibrosis, TGF-β signaling modulation, and kidney injury-associated molecular pathways.

Pack Size	Price	USA Stock	Global Stock
500 µg	$97	Inquiry	Inquiry
1 mg	$185	Inquiry	Inquiry
5 mg	$580	Inquiry	Inquiry
10 mg	$964	Inquiry	Inquiry

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Product Introduction

Bioactivity

Description	Klotho-derived Peptide 1 (56-87) (human) TFA, a peptide derived from the human Klotho protein, disrupts TGF-β signaling through binding interactions with TGF-β receptor type 1 (TGFBR1) and TGF-β receptor type 2 (TGFBR2), with Kd values of 1.41 and 14.6 µM, respectively. Preincubation with Klotho-derived Peptide 1 (56-87) (human) TFA at 10 µg/mL inhibits TGF-β-induced increases in fibronectin and α-smooth muscle actin (α-SMA) expression in NRK-49F rat fibroblasts. In vivo investigations demonstrate that Klotho-derived Peptide 1 (56-87) (human) TFA, administered at 1 mg/kg per day, preferentially accumulates in damaged kidneys and significantly reduces serum creatinine and blood urea nitrogen levels while decreasing renal fibrosis in mouse models of unilateral ureteral obstruction (UUO) and unilateral ischemia-reperfusion injury-induced renal fibrosis. Klotho-derived Peptide 1 (56-87) (human) TFA is therefore valuable for investigations involving renal fibrosis, TGF-β signaling modulation, and kidney injury-associated molecular pathways.
In vitro	Klotho-derived Peptide 1 (56-87) (human) TFA (3μM, 24 h) blocks TGF-β1-induced α-SMA and fibronectin expression at protein levels by western blot analyses[1]. Klotho-derived Peptide 1 (56-87) (human) TFA (3μM, 24 h) concurrently suppresses the ERK1/2, JNK, and p38 MAPK activation induced by TGF-β1 in LX-2 cells[1].
In vivo	Klotho-derived Peptide 1 (56-87) (human) TFA (1 mg/kg/d) normalizes serum ALT and AST levels ALB and TP levels and inhibits hepatic mRNA expression of numerous fibrosis-related genes such as α-smooth muscle actin (Acta2), Fn1, Col1a1, Col3a1, tissue Inhibitor of metalloproteinase 2 (Timp2), and matrix metalloproteinase-9 (Mmp9) in kl/kl mice[1]. Klotho-derived Peptide 1 (56-87) (human) TFA (1 mg/kg/d; 4weeks) reduces pseudolobule formation, hepatocyte ballooning, and inflammatory infiltration and attenuats collagens deposition in the liver of CCl4 treated mice[1]. Klotho-derived Peptide 1 (56-87) (human) TFA (1 mg/kg/d; i.v.; 1weeks) reduced serum ALT and AST levels after bile duct ligation (BDL) surgery and mitigates hepatic damage and inflammatory infiltration in BDL liver[1].
Synonyms	KP1 (56-87) (human) TFA

Chemical Properties

Molecular Weight	3228.44 (free base)
Formula	C₁₄₉H₂₀₃N₃₉O₄₃.xCF₃COOH
Smiles	[H]N[C@H](C(N[C@@H](CCC(N)=O)C(NCC(N[C@]([C@@H](C)O)([H])C(N[C@H](C(N1CCC[C@H]1C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CC(C)C)C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@]([C@@H](C)O)([H])C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@H](C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)CC2=CN=CN2)=O)=O)=O)CC3=CNC4=C3C=CC=C4)=O)=O)=O)=O)=O)=O)CC5=CC=C(O)C=C5)=O)C)=O)C)=O)=O)=O)=O)C)=O)CC6=CNC7=C6C=CC=C7)=O)=O)CC8=CC=CC=C8)=O)=O)CC(O)=O)=O)=O)CC9=CC=CC=C9)=O)=O)=O)=O)CC%10=CC=CC=C%10.FC(F)(C(O)=O)F
Sequence	Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly
Sequence Short	FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG

Storage & Solubility Information

Storage	Keep away from moisture, Powder: -20°C for 3 years \| In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.
Solubility Information	H2O: Soluble

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 µL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 µL Tween 80 and mix well until fully clarified.

3) Add 450 µL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

KP1 (56-87)

Related Tags: Klotho-derived Peptide 1 (56-87) (human) TFA chemical structure | Klotho-derived Peptide 1 (56-87) (human) TFA in vivo | Klotho-derived Peptide 1 (56-87) (human) TFA in vitro | Klotho-derived Peptide 1 (56-87) (human) TFA formula | Klotho-derived Peptide 1 (56-87) (human) TFA molecular weight