Shopping Cart
- Remove All
- Your shopping cart is currently empty
Insulin glargine, a long-acting insulin analog, is utilized for the treatment of diabetes mellitus [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Insulin glargine, a long-acting insulin analog, is utilized for the treatment of diabetes mellitus [1]. |
Molecular Weight | 6062.89 |
Formula | C267H404N72O78S6 |
Cas No. | 160337-95-1 |
Sequence | A-chain: Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Gly; B-chain: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg (Disulfide bridge: CysA6 |
Sequence Short | A-chain: GIVEQCCTSICSLYQLENYCG; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.