Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human β-defensin-3 (HβD-3) is an antibiotic antimicrobial peptide synthesized by epithelial cells. It exhibits potent antimicrobial properties, mitigates inflammatory cytokine responses, and targets various microorganisms with IC90 values ranging from 6 to 25 μg/ml.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Human β-defensin-3 (HβD-3) is an antibiotic antimicrobial peptide synthesized by epithelial cells. It exhibits potent antimicrobial properties, mitigates inflammatory cytokine responses, and targets various microorganisms with IC90 values ranging from 6 to 25 μg/ml. |
Synonyms | HβD-3, Human β-defensin-3 |
Cas No. | 221230-01-9 |
Sequence | Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys (Disulfide bridge:Cys11-Cys40;Cys18-Cys33;Cys23-Cys41) |
Sequence Short | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge:Cys11-Cys40;Cys18-Cys33;Cys23-Cys41) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.