Shopping Cart
- Remove All
- Your shopping cart is currently empty
GsAF-1, a peptide toxin with three disulfide bonds, is derived from the venom of the Chilean pink tarantula and has potential applications in the research of moderate-to-severe pain [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GsAF-1, a peptide toxin with three disulfide bonds, is derived from the venom of the Chilean pink tarantula and has potential applications in the research of moderate-to-severe pain [1]. |
Cas No. | 518309-03-0 |
Sequence | Tyr-Cys-Gln-Lys-Trp-Leu-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2 |
Sequence Short | YCQKWLWTCDSERKCCEDMVCRLWCKKRL-NH2 (Disulfide bonds:Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.