Shopping Cart
- Remove All
- Your shopping cart is currently empty
GLP-1 (1-36) amide (human, rat) is a molecular variant of the GLP-1 (7-36) amide and has the capacity to stimulate [14C]aminopyrine accumulation in enzymatically dispersed, enriched rat parietal cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GLP-1 (1-36) amide (human, rat) is a molecular variant of the GLP-1 (7-36) amide and has the capacity to stimulate [14C]aminopyrine accumulation in enzymatically dispersed, enriched rat parietal cells [1]. |
Synonyms | Glucagon-like Peptide 1 (1-36) amide (human, rat) |
Molecular Weight | 4111.44 |
Formula | C184H273N51O57 |
Cas No. | 99658-04-5 |
Sequence | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
Sequence Short | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.