Shopping Cart
- Remove All
- Your shopping cart is currently empty
GHRF, ovine, is a growth hormone-releasing factor that specifically mediates the effects of hypoglycemia on the release of pituitary growth hormone (GH) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | GHRF, ovine, is a growth hormone-releasing factor that specifically mediates the effects of hypoglycemia on the release of pituitary growth hormone (GH) [1]. |
In vitro | GHRF (1-100 nM; 1 h) induces a calcium- and dose-dependent increase in somatostatin secretion from dispersed adult rat hypothalamic cells [2]. |
Molecular Weight | 5121.87 |
Formula | C221H368N72O66S |
Cas No. | 94948-82-0 |
Sequence Short | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.