Shopping Cart
Remove All
Your shopping cart is currently empty
GHRF, ovine, is a growth hormone-releasing factor that specifically mediates the effects of hypoglycemia on the release of pituitary growth hormone (GH) [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | GHRF, ovine, is a growth hormone-releasing factor that specifically mediates the effects of hypoglycemia on the release of pituitary growth hormone (GH) [1]. |
| In vitro | GHRF (1-100 nM; 1 h) induces a calcium- and dose-dependent increase in somatostatin secretion from dispersed adult rat hypothalamic cells [2]. |
| Molecular Weight | 5121.87 |
| Formula | C221H368N72O66S |
| Cas No. | 94948-82-0 |
| Sequence Short | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.