Shopping Cart
- Remove All
- Your shopping cart is currently empty
GHRF, porcine, a growth hormone releasing factor (GHRF) peptide (porcine), binds to the growth hormone secretagogue receptor (GHSR), thereby inducing the release of growth hormone [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | GHRF, porcine, a growth hormone releasing factor (GHRF) peptide (porcine), binds to the growth hormone secretagogue receptor (GHSR), thereby inducing the release of growth hormone [1] [2]. |
Molecular Weight | 5108.76 |
Formula | C219H365N73O66S |
Cas No. | 88384-73-0 |
Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.