Shopping Cart
- Remove All
- Your shopping cart is currently empty
Gallin, an antimicrobial peptide originating from egg whites, demonstrates inhibitory effects on Escherichia coli growth at a concentration of 0.25 μM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Gallin, an antimicrobial peptide originating from egg whites, demonstrates inhibitory effects on Escherichia coli growth at a concentration of 0.25 μM [1]. |
Molecular Weight | 4725.6 |
Formula | C213H320N54O54S7 |
Sequence | Leu-Val-Leu-Lys-Tyr-Cys-Pro-Lys-Ile-Gly-Tyr-Cys-Ser-Asn-Thr-Cys-Ser-Lys-Thr-Gln-Ile-Trp-Ala-Thr-Ser-His-Gly-Cys-Lys-Met-Tyr-Cys-Cys-Leu-Pro-Ala-Ser-Trp-Lys-Trp-Lys (Disulfide bridge:Cys4-Cys10;Cys5-Cys18) |
Sequence Short | LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK (Disulfide bridge:Cys4-Cys10;Cys5-Cys18) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.