Shopping Cart
- Remove All
- Your shopping cart is currently empty
Fasciculin-I, a toxin isolated from mamba venom, exerts its toxicity primarily by inhibiting acetylcholinesterase (AChE). Additionally, it impedes the action of α-neurotoxins on nicotinic acetylcholine receptors and neutralizes cardiac toxins that interact with cell membranes [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Fasciculin-I, a toxin isolated from mamba venom, exerts its toxicity primarily by inhibiting acetylcholinesterase (AChE). Additionally, it impedes the action of α-neurotoxins on nicotinic acetylcholine receptors and neutralizes cardiac toxins that interact with cell membranes [1]. |
Synonyms | FAS-I |
Sequence | Thr-Met-Cys-Tyr-Ser-His-Thr-Thr-Thr-Ser-Arg-Ala-Ile-Leu-Thr-Asn-Cys-Gly-Glu-Asn-Ser-Cys-Tyr-Arg-Lys-Ser-Arg-Arg-His-Pro-Pro-Lys-Met-Val-Leu-Gly-Arg-Gly-Cys-Gly-Cys-Pro-Pro-Gly-Asp-Asp-Tyr-Leu-Glu-Val-Lys-Cys-Cys-Thr-Ser-Pro-Asp-Lys-Cys-Asn-Tyr (Disulfide |
Sequence Short | TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY (Disulfide bridge:Cys3-Cys22;Cys17-Cys39;Cys41-Cys52;Cys53-Cys59) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.