Your shopping cart is currently empty

Brain natriuretic peptide-32 (BNP-32), a fragment of the proBNP cardiovascular hormone precursor, exhibits affinity for natriuretic peptide receptors in rat vascular smooth muscle cells (IC50 = 7.3 nM) and promotes cGMP accumulation within these cells (EC50 = 170 nM). Additionally, BNP-32 effectively mediates the relaxation of norepinephrine-precontracted isolated rat aortic strips (EC50 = 6.7 nM). Upon administration at a dosage of 3 µg/kg, it elevates urine and urinary electrolyte outputs and induces hypotension in rats.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $97 | Inquiry | Inquiry | |
| 5 mg | $437 | Inquiry | Inquiry | |
| 10 mg | $821 | Inquiry | Inquiry |
| Description | Brain natriuretic peptide-32 (BNP-32), a fragment of the proBNP cardiovascular hormone precursor, exhibits affinity for natriuretic peptide receptors in rat vascular smooth muscle cells (IC50 = 7.3 nM) and promotes cGMP accumulation within these cells (EC50 = 170 nM). Additionally, BNP-32 effectively mediates the relaxation of norepinephrine-precontracted isolated rat aortic strips (EC50 = 6.7 nM). Upon administration at a dosage of 3 µg/kg, it elevates urine and urinary electrolyte outputs and induces hypotension in rats. |
| Synonyms | B-type Natriuretic Peptide-32, Brain Natriuretic Polypeptide-32, BNP-32, BNP (14-45) |
| Molecular Weight | 3452.90 |
| Formula | C146H239N47O44S3.XC2H4O2 |
| Smiles | O=C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@@H](CCSC)C(N[C@H](C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CO)C(N[C@@H](CSSC[C@H](N2)C(N[C@@H](CC(O)=O)C(NCC(N[C@H](C(N[C@@H](CCC/N=C(N)/N)C(N[C@H](C(N[C@H](C(O)=O)CC3=CC=CC=C3)=O)CC(C)C)=O)=O)CC(C)C)=O)=O)=O)C(N[C@H](C(NCC(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@](C(N[C@@H](CC(O)=O)C(N[C@@H](CCC/N=C(N)/N)C(N[C@@](C(NCC(N[C@H](C(N[C@@H](C(C)C)C(N[C@@H](CO)C(N[C@@H](CCC/N=C(N)/N)C(N[C@H](C(NCC2=O)=O)CC(C)C)=O)=O)=O)=O)C)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)([H])[C@@H](C)CC)=O)=O)=O)=O)CC4=CC=CC=C4)=O)=O)=O)=O)=O)=O)C)=O)=O)=O)[C@H](CC(N)=O)N[H].CC(O)=O |
| Sequence | H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys(1)-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys(1)-Lys-Val-Leu-Arg-Arg-His-OH |
| Sequence Short | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.