Shopping Cart
- Remove All
Your shopping cart is currently empty
Brain natriuretic peptide-32 (BNP-32), a fragment of the proBNP cardiovascular hormone precursor, exhibits affinity for natriuretic peptide receptors in rat vascular smooth muscle cells (IC50 = 7.3 nM) and promotes cGMP accumulation within these cells (EC50 = 170 nM). Additionally, BNP-32 effectively mediates the relaxation of norepinephrine-precontracted isolated rat aortic strips (EC50 = 6.7 nM). Upon administration at a dosage of 3 µg/kg, it elevates urine and urinary electrolyte outputs and induces hypotension in rats.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $97 | Backorder | |
| 5 mg | $437 | Backorder | |
| 10 mg | $821 | Backorder |
| Description | Brain natriuretic peptide-32 (BNP-32), a fragment of the proBNP cardiovascular hormone precursor, exhibits affinity for natriuretic peptide receptors in rat vascular smooth muscle cells (IC50 = 7.3 nM) and promotes cGMP accumulation within these cells (EC50 = 170 nM). Additionally, BNP-32 effectively mediates the relaxation of norepinephrine-precontracted isolated rat aortic strips (EC50 = 6.7 nM). Upon administration at a dosage of 3 µg/kg, it elevates urine and urinary electrolyte outputs and induces hypotension in rats. |
| Synonyms | B-type Natriuretic Peptide-32, Brain Natriuretic Polypeptide-32, BNP-32, BNP (14-45) |
| Molecular Weight | 3452.90 |
| Formula | C146H239N47O44S3.XC2H4O2 |
| Sequence | H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys(1)-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys(1)-Lys-Val-Leu-Arg-Arg-His-OH |
| Sequence Short | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.