Shopping Cart
- Remove All
- Your shopping cart is currently empty
Bovine tracheal antimicrobial peptide, derived from the tracheal mucosa, exhibits antimicrobial efficacy against E. coli D31, K. pneumoniae 13883, S. aureus 25923, P. aeruginosa 27853, and C. albicans 14053, with respective minimum inhibitory concentration (MIC) values ranging from 12-25 μg/ml for the first two pathogens, 25-50 μg/ml for the following two, and 6-12 μg/ml for the latter [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Bovine tracheal antimicrobial peptide, derived from the tracheal mucosa, exhibits antimicrobial efficacy against E. coli D31, K. pneumoniae 13883, S. aureus 25923, P. aeruginosa 27853, and C. albicans 14053, with respective minimum inhibitory concentration (MIC) values ranging from 12-25 μg/ml for the first two pathogens, 25-50 μg/ml for the following two, and 6-12 μg/ml for the latter [1]. |
Molecular Weight | 4084.98 |
Formula | C169H296N58O45S7 |
Sequence | Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met-Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
Sequence Short | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.