Your shopping cart is currently empty

Bovine tracheal antimicrobial peptide, derived from the tracheal mucosa, exhibits antimicrobial efficacy against E. coli D31, K. pneumoniae 13883, S. aureus 25923, P. aeruginosa 27853, and C. albicans 14053, with respective minimum inhibitory concentration (MIC) values ranging from 12-25 μg/ml for the first two pathogens, 25-50 μg/ml for the following two, and 6-12 μg/ml for the latter [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Bovine tracheal antimicrobial peptide, derived from the tracheal mucosa, exhibits antimicrobial efficacy against E. coli D31, K. pneumoniae 13883, S. aureus 25923, P. aeruginosa 27853, and C. albicans 14053, with respective minimum inhibitory concentration (MIC) values ranging from 12-25 μg/ml for the first two pathogens, 25-50 μg/ml for the following two, and 6-12 μg/ml for the latter [1]. |
| Molecular Weight | 4084.98 |
| Formula | C169H296N58O45S7 |
| Sequence | Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met-Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Sequence Short | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.