Shopping Cart
- Remove All
- Your shopping cart is currently empty
Beta-defensin 103 isoform X1, pig, is an antimicrobial peptide found in various organisms, essential for the initial defense mechanisms of the innate immune system against pathogens [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Beta-defensin 103 isoform X1, pig, is an antimicrobial peptide found in various organisms, essential for the initial defense mechanisms of the innate immune system against pathogens [1]. |
Molecular Weight | 7790.54 |
Formula | C346H575N105O83S8 |
Sequence | Met-Arg-Ile-His-Tyr-Leu-Leu-Phe-Ala-Leu-Leu-Phe-Leu-Phe-Leu-Met-Pro-Leu-Pro-Gly-Asn-Gly-Arg-Ile-Ile-Asn-Thr-Leu-Gln-Arg-Tyr-Tyr-Cys-Lys-Ile-Arg-Arg-Gly-Arg-Cys-Ala-Val-Leu-Gly-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Ser-Cys-Ser-Val-Ser-Gly-Arg-Lys-Cys-Cys-Arg |
Sequence Short | MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.