Shopping Cart
- Remove All
- Your shopping cart is currently empty
Beta-defensin 1, pig TFA, an antimicrobial peptide predominantly located in the tongue mucosa of pigs, exhibits activity against a diverse range of bacteria including Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis, and the fungus Candida albicans [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Beta-defensin 1, pig TFA, an antimicrobial peptide predominantly located in the tongue mucosa of pigs, exhibits activity against a diverse range of bacteria including Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis, and the fungus Candida albicans [1] [2]. |
Molecular Weight | 7524.92 |
Formula | C323H535N92F3O92S9 |
Sequence | Met-Arg-Ala-Leu-Cys-Leu-Leu-Leu-Leu-Thr-Val-Cys-Leu-Leu-Ser-Ser-Gln-Leu-Ala-Ala-Gly-Ile-Asn-Leu-Leu-Thr-Gly-Leu-Gly-Gln-Arg-Ser-Asp-His-Tyr-Ile-Cys-Ala-Lys-Lys-Gly-Gly-Thr-Cys-Asn-Phe-Ser-Pro-Cys-Pro-Leu-Phe-Asn-Arg-Ile-Glu-Gly-Thr-Cys-Tyr-Ser-Gly-Lys-Ala |
Sequence Short | MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.