Shopping Cart
Remove All
Your shopping cart is currently empty
Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | $2,891 | Inquiry | Inquiry |
| Description | Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective. |
| Molecular Weight | 4708.37 |
| Formula | C210H297N57O56S6 |
| Relative Density. | 1.31g/cm3 |
| Sequence | Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Sequence Short | AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Disulfide bonds:Cys4-Cys39, Cys6-Cys32, Cys22-Cys40) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL (0.21 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.