Shopping Cart
- Remove All
- Your shopping cart is currently empty
ASB20123, a CNP/ghrelin chimeric peptide, promotes bone growth and has potential research applications in growth disorders and dwarfism [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | ASB20123, a CNP/ghrelin chimeric peptide, promotes bone growth and has potential research applications in growth disorders and dwarfism [1]. |
Sequence | Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Val-Gln-Gln-Arg-Lys-Asp-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg (Disulfide bridge: Cys6-Cys22) |
Sequence Short | GLSKGCFGLKLDRIGSMSGLGCVQQRKDSKKPPAKLQPR (Disulfide bridge: Cys6-Cys22) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.