Shopping Cart
- Remove All
Your shopping cart is currently empty
Alpha-Cobratoxin, a neurotoxin isolated from Thai cobra venom, displays neuromodulatory, antiviral, and analgesic activities, as well as potent immunosuppressive effects in the treatment of acute and chronic multiple sclerosis. It is currently under investigation for its potential application in adrenomyeloneuropathy [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Alpha-Cobratoxin, a neurotoxin isolated from Thai cobra venom, displays neuromodulatory, antiviral, and analgesic activities, as well as potent immunosuppressive effects in the treatment of acute and chronic multiple sclerosis. It is currently under investigation for its potential application in adrenomyeloneuropathy [1]. |
| Cas No. | 769933-79-1 |
| Sequence | Ile-Arg-Cys-Phe-Ile-Thr-Pro-Asp-Ile-Thr-Ser-Lys-Asp-Cys-Pro-Asn-Gly-His-Val-Cys-Tyr-Thr-Lys-Thr-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ile-Arg-Gly-Lys-Arg-Val-Asp-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Thr-Val-Lys-Thr-Gly-Val-Asp-Ile-Gln-Cys-Cys-Ser-Thr-Asp-Asn-Cys-Asn-Pro |
| Sequence Short | IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP (Disulfide bonds:Cys3-Cys20, Cys14-Cys41, Cys26-Cys30, Cys45-Cys56, Cys57-Cys62) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.