Shopping Cart
- Remove All
- Your shopping cart is currently empty
AaHI, a neurotoxin sourced from the venom of the North African scorpion Androctonus australis hector, serves as a research tool for creating agents with the ability to neutralize toxins [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | AaHI, a neurotoxin sourced from the venom of the North African scorpion Androctonus australis hector, serves as a research tool for creating agents with the ability to neutralize toxins [1]. |
Cas No. | 820981-26-8 |
Sequence | Lys-Arg-Asp-Gly-Tyr-Ile-Val-Tyr-Pro-Asn-Asn-Cys-Val-Tyr-His-Cys-Val-Pro-Pro-Cys-Asp-Gly-Leu-Cys-Lys-Lys-Asn-Gly-Gly-Ser-Ser-Gly-Ser-Cys-Ser-Phe-Leu-Val-Pro-Ser-Gly-Leu-Ala-Cys-Trp-Cys-Lys-Asp-Leu-Pro-Asp-Asn-Val-Pro-Ile-Lys-Asp-Thr-Ser-Arg-Lys-Cys-Thr (Di |
Sequence Short | KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVPSGLACWCKDLPDNVPIKDTSRKCT (Disulfide bridge:Cys12-Cys62;Cys16-Cys34;Cys20-Cys44;Cys24-Cys46) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.