Shopping Cart
Remove All
Your shopping cart is currently empty
α-Hemolysin (Staphylococcus aureus), a polypeptide virulence factor of Staphylococcus aureus, disrupts host cell plasma membranes. Upon binding to the cell surface, its monomers create a homoheptamic prepore, which evolves into a mature transmembrane pore, facilitating K+ and Ca2+ ion transport that induces necrotic death in target cells [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | α-Hemolysin (Staphylococcus aureus), a polypeptide virulence factor of Staphylococcus aureus, disrupts host cell plasma membranes. Upon binding to the cell surface, its monomers create a homoheptamic prepore, which evolves into a mature transmembrane pore, facilitating K+ and Ca2+ ion transport that induces necrotic death in target cells [1]. |
| In vitro | α-Hemolysin (Staphylococcus aureus) induces IL-1β secretion and caspase-1 activation in THP-1 cells via NLRP3 inflammasome-dependent caspase-1 activation [1]. Additionally, α-hemolysin (Staphylococcus aureus)(1 µg/mL, 4h) triggers cell death in derivatives of THP cells, which requires host NLRP3 signaling but is independent of caspase-1 activation and IL-1β secretion [1]. |
| Cas No. | 94716-94-6 |
| Sequence | Ala-Asp-Ser-Asp-Ile-Asn-Ile-Lys-Thr-Gly-Thr-Thr-Asp-Ile-Gly-Ser-Asn-Thr-Thr-Val-Lys-Thr-Gly-Asp-Leu-Val-Thr-Tyr-Asp-Lys-Glu-Asn-Gly-Met-His-Lys-Lys-Val-Phe-Tyr-Ser-Phe-Ile-Asp-Asp-Lys-Asn-Ala-Ile-Lys-Lys-Leu-Leu-Val-Ile-Arg-Thr-Lys-Gly-Thr-Ile-Ala-Gly-Gln |
| Sequence Short | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNAIKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAEISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.