Your shopping cart is currently empty

α-Hemolysin (Staphylococcus aureus), a polypeptide virulence factor of Staphylococcus aureus, disrupts host cell plasma membranes. Upon binding to the cell surface, its monomers create a homoheptamic prepore, which evolves into a mature transmembrane pore, facilitating K+ and Ca2+ ion transport that induces necrotic death in target cells [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | α-Hemolysin (Staphylococcus aureus), a polypeptide virulence factor of Staphylococcus aureus, disrupts host cell plasma membranes. Upon binding to the cell surface, its monomers create a homoheptamic prepore, which evolves into a mature transmembrane pore, facilitating K+ and Ca2+ ion transport that induces necrotic death in target cells [1]. |
| In vitro | α-Hemolysin (Staphylococcus aureus) induces IL-1β secretion and caspase-1 activation in THP-1 cells via NLRP3 inflammasome-dependent caspase-1 activation [1]. Additionally, α-hemolysin (Staphylococcus aureus)(1 µg/mL, 4h) triggers cell death in derivatives of THP cells, which requires host NLRP3 signaling but is independent of caspase-1 activation and IL-1β secretion [1]. |
| Cas No. | 94716-94-6 |
| Sequence | Ala-Asp-Ser-Asp-Ile-Asn-Ile-Lys-Thr-Gly-Thr-Thr-Asp-Ile-Gly-Ser-Asn-Thr-Thr-Val-Lys-Thr-Gly-Asp-Leu-Val-Thr-Tyr-Asp-Lys-Glu-Asn-Gly-Met-His-Lys-Lys-Val-Phe-Tyr-Ser-Phe-Ile-Asp-Asp-Lys-Asn-Ala-Ile-Lys-Lys-Leu-Leu-Val-Ile-Arg-Thr-Lys-Gly-Thr-Ile-Ala-Gly-Gln |
| Sequence Short | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNAIKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAEISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.