TEAD4 Protein, Human, Recombinant (His & Myc)

Name: TEAD4 Protein, Human, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-02224
Rating: 4.5 (1 reviews)

(Synonyms: Transcriptional enhancer factor TEF-3, Transcription factor RTEF-1, Transcription factor 13-like 1, TEF3, TEAD4, TEA domain family member 4 (TEAD-4), TCF13L1, RTEF1) Copy Product Info

Synonyms: Transcriptional enhancer factor TEF-3, Transcription factor RTEF-1, Transcription factor 13-like 1, TEF3, TEAD4, TEA domain family member 4 (TEAD-4), TCF13L1, RTEF1

Catalog No. TMPH-02224 Copy Product Info

TEAD4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 44.5 kDa and the accession number is Q15561.

Pack Size	Price	USA Stock	Global Stock
5 μg	$108	20 days	20 days
10 μg	$177	20 days	20 days
20 μg	$293	20 days	20 days
50 μg	$549	20 days	20 days
100 μg	$890	20 days	20 days
200 μg	$1,090	20 days	20 days
500 μg	$1,430	20 days	20 days
1 mg	$1,780	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity


Description	TEAD4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 44.5 kDa and the accession number is Q15561.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	Q15561
Amino Acid	MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Construction	74-434 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Transcriptional enhancer factor TEF-3, Transcription factor RTEF-1, Transcription factor 13-like 1, TEF3, TEAD4, TEA domain family member 4 (TEAD-4), TCF13L1, RTEF1
Research Background

Chemical Properties

Molecular Weight

44.5 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

TEF 3TEAD-4TEAD 4TCF13L 1RTEF 1

Related Tags: TEAD4 Protein, Human, Recombinant (His & Myc) chemical structure | TEAD4 Protein, Human, Recombinant (His & Myc) molecular weight