TEAD4 Protein, Mouse, Recombinant

Name: TEAD4 Protein, Mouse, Recombinant
Brand: TargetMol
SKU: TMPH-02943
Rating: 4.5 (1 reviews)

(Synonyms: Transcriptional enhancer factor TEF-3, Tefr1, Tef3, TEF-1-related factor FR-19 (RTEF-1), TEF-1-related factor 1, Tead4, TEA domain family member 4 (TEAD-4), Tcf13r1, ETF-related factor 2 (ETFR-2)) Copy Product Info

Synonyms: Transcriptional enhancer factor TEF-3, Tefr1, Tef3, TEF-1-related factor FR-19 (RTEF-1), TEF-1-related factor 1, Tead4, TEA domain family member 4 (TEAD-4), Tcf13r1, ETF-related factor 2 (ETFR-2)

Catalog No. TMPH-02943 Copy Product Info

TEAD4 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 25.7 kDa and the accession number is Q62296.

Pack Size	Price	USA Stock	Global Stock
5 µg	$185	20 days	20 days
10 µg	$297	20 days	20 days
20 µg	$515	20 days	20 days
50 µg	$713	20 days	20 days
100 µg	$916	20 days	20 days
200 µg	$1,260	20 days	20 days
500 µg	$1,930	20 days	20 days
1 mg	$2,690	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	TEAD4 Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 25.7 kDa and the accession number is Q62296.
Species	Mouse
Expression System	E. coli
Tag	Tag Free
Accession Number	Q62296
Amino Acid	RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Construction	210-427 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Transcriptional enhancer factor TEF-3, Tefr1, Tef3, TEF-1-related factor FR-19 (RTEF-1), TEF-1-related factor 1, Tead4, TEA domain family member 4 (TEAD-4), Tcf13r1, ETF-related factor 2 (ETFR-2)
Research Background	Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif. Might play a role in the embryonic development of skeletal muscle.

Chemical Properties

Molecular Weight

25.7 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.