Tb2-II Protein, Tityus bahiensis, Recombinant (His & Myc)

Catalog No. TMPH-03623 Copy Product Info

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active against both mammals and insects. Tb2-II Protein, Tityus bahiensis, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.8 kDa and the accession number is P60276.

Tb2-II Protein, Tityus bahiensis, Recombinant (His & Myc)

Catalog No. TMPH-03623

Copy Product Info

Tb2-II Protein, Tityus bahiensis, Recombinant (His & Myc)

Pack Size	Price	USA Stock	Global Stock
5 μg	$176	20 days	20 days
10 μg	$293	20 days	20 days
20 μg	$491	20 days	20 days
50 μg	$926	20 days	20 days
100 μg	$1,500	20 days	20 days
200 μg	$1,750	20 days	20 days
500 μg	$2,150	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active against both mammals and insects. Tb2-II Protein, Tityus bahiensis, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 10.8 kDa and the accession number is P60276.
Species	Tityus bahiensis
Expression System	Baculovirus Insect Cells
Tag	N-10xHis, C-Myc
Accession Number	P60276
Synonyms	Toxin Tb2-II,P-Mice-Ins-beta* NaTx5.4
Amino Acid	KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC
Construction	1-62 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	10.8 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active against both mammals and insects.