Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Toxin Tb2-II, P-Mice-Ins-beta* NaTx5.4

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 μg | $129 | 20 days | 20 days | |
| 10 μg | $216 | 20 days | 20 days | |
| 20 μg | $360 | 20 days | 20 days | |
| 50 μg | $543 | 20 days | 20 days | |
| 100 μg | $745 | 20 days | 20 days | |
| 200 μg | $1,070 | 20 days | 20 days | |
| 500 μg | $1,730 | 20 days | 20 days | |
| 1 mg | $2,530 | 20 days | 20 days |
| Description | Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active against both mammals and insects. Tb2-II Protein, Tityus bahiensis, Recombinant (E. coli, His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 12.0 kDa and the accession number is P60276. |
| Species | Tityus bahiensis |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P60276 |
| Amino Acid | KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC |
| Construction | 1-62 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Synonyms | Toxin Tb2-II, P-Mice-Ins-beta* NaTx5.4 |
| Research Background |
| Molecular Weight | 12.0 kDa (predicted) |
| Storage | Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.