Rotavirus A (strain St. Thomas 3) VP7 Protein (B2M & His)

Name: Rotavirus A (strain St. Thomas 3) VP7 Protein (B2M & His)
Brand: TargetMol
SKU: TMPH-03423
Rating: 4.5 (1 reviews)

(Synonyms: Outer capsid glycoprotein VP7) Copy Product Info

Synonyms: Outer capsid glycoprotein VP7

Catalog No. TMPH-03423 Copy Product Info

Rotavirus A (strain St. Thomas 3) VP7 Protein (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 45.3 kDa and the accession number is P10501.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Rotavirus A (strain St. Thomas 3) VP7 Protein (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 45.3 kDa and the accession number is P10501.
Species	RV-A
Expression System	E. coli
Tag	N-6xHis-B2M
Accession Number	P10501
Amino Acid	QNYGINLPITGSMDTAYANSTQDNNFLFSTLCLYYPSEAPTQISDTEWKDTLSQLFLTKGWPTGSVYFNEYSNVLEFSIDPKLYCDYNVVLIRFVSGEELDISELADLILNEWLCNPMDITLYYYQQTGEANKWISMGSSCTVKVCPLNTQTLGIGCQTTNTATFETVADSEKLAIIDVVDSVNHKLNITSTTCTIRNCNKLGPRENVAIIQVGGSNILDITADPTTSPQTERMMRVNWKKWWQVFYTVVDYINQIVQVMSKRSRSLDSSSFYYRV
Construction	51-326 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Outer capsid glycoprotein VP7
Research Background	Calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.

Chemical Properties

Molecular Weight

45.3 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Related Tags: Rotavirus A (strain St. Thomas 3) VP7 Protein (B2M & His) chemical structure | Rotavirus A (strain St. Thomas 3) VP7 Protein (B2M & His) molecular weight