Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) VP7 Protein (His & Myc)

Catalog No. TMPH-03421

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) VP7 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.0 kDa and the accession number is A8D8S8.

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) VP7 Protein (His & Myc)

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) VP7 Protein (His & Myc)

Catalog No. TMPH-03421
Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) VP7 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.0 kDa and the accession number is A8D8S8.
Pack SizePriceAvailabilityQuantity
20 μg $28420 days
100 μg $59020 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) VP7 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.0 kDa and the accession number is A8D8S8.
Species
RV-A
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberA8D8S8
Synonyms
Outer capsid glycoprotein VP7
Amino Acid
QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV
Construction
34-309 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight36.0 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca(2+) concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.