Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

RETNLB Protein, Human, Recombinant (His)

Name: RETNLB Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02027
Rating: 4.5 (1 reviews)

(Synonyms: RETNLB, RETNL2, Resistin-like beta, RELMbeta, HXCP2, FIZZ2, Cysteine-rich secreted protein FIZZ2, Cysteine-rich secreted protein A12-alpha-like 1, Colon carcinoma-related gene protein, Colon and small intestine-specific cysteine-rich protein, CCRG) Copy Product Info

Synonyms: RETNLB, RETNL2, Resistin-like beta, RELMbeta, HXCP2, FIZZ2, Cysteine-rich secreted protein FIZZ2, Cysteine-rich secreted protein A12-alpha-like 1, Colon carcinoma-related gene protein, Colon and small intestine-specific cysteine-rich protein, CCRG

Catalog No. TMPH-02027 Copy Product Info

Probable hormone. RETNLB Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is Q9BQ08.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 μg	$75	20 days	20 days
10 μg	$119	20 days	20 days
20 μg	$198	20 days	20 days
50 μg	$297	20 days	20 days
100 μg	$427	20 days	20 days
200 μg	$658	20 days	20 days
500 μg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Probable hormone. RETNLB Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is Q9BQ08.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q9BQ08
Amino Acid	QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Construction	24-111 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	RETNLB, RETNL2, Resistin-like beta, RELMbeta, HXCP2, FIZZ2, Cysteine-rich secreted protein FIZZ2, Cysteine-rich secreted protein A12-alpha-like 1, Colon carcinoma-related gene protein, Colon and small intestine-specific cysteine-rich protein, CCRG
Research Background

Chemical Properties

Molecular Weight

13.4 kDa (predicted)

Storage & Solubility Information

Storage

Store at low temperature Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

RETNL 2Resistin-likeβResistin-like βResistin-like bRELM-βRELMβRELMbHXCP 2FIZZ 2Cysteine-rich secreted protein A12-α-like 1Cysteine-rich secreted protein A12-a-like 1

Related Tags: RETNLB Protein, Human, Recombinant (His) chemical structure | RETNLB Protein, Human, Recombinant (His) molecular weight