Shopping Cart
Remove All
Your shopping cart is currently empty
Recoverin Protein, Human, Recombinant (His & Myc)
(Synonyms: Recoverin, RCVRN, RCV1, Cancer-associated retinopathy protein (Protein CAR)) Copy Product InfoSynonyms: Recoverin, RCVRN, RCV1, Cancer-associated retinopathy protein (Protein CAR)
Catalog No. TMPH-02015 Copy Product Info
Recoverin Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 27.0 kDa and the accession number is P35243.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $197 | 20 days | 20 days | |
| 10 µg | $327 | 20 days | 20 days | |
| 20 µg | $549 | 20 days | 20 days | |
| 50 µg | $987 | 20 days | 20 days | |
| 100 µg | $1,690 | 20 days | 20 days |
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Recoverin Protein, Human, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 27.0 kDa and the accession number is P35243. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | N-10xHis, C-Myc |
| Accession Number | P35243 |
| Amino Acid | GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
| Construction | 2-200 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Recoverin, RCVRN, RCV1, Cancer-associated retinopathy protein (Protein CAR) |
| Research Background | Acts as a calcium sensor and regulates phototransduction of cone and rod photoreceptor cells. Modulates light sensitivity of cone photoreceptor in dark and dim conditions. In response to high Ca(2+) levels induced by low light levels, prolongs RHO/rhodopsin activation in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. Plays a role in scotopic vision/enhances vision in dim light by enhancing signal transfer between rod photoreceptors and rod bipolar cells. Improves rod photoreceptor sensitivity in dim light and mediates response of rod photoreceptors to facilitate detection of change and motion in bright light. |
| Molecular Weight | 27.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Recombinant Proteins
Keywords
Preview
Related Tags: Recoverin Protein, Human, Recombinant (His & Myc) chemical structure | Recoverin Protein, Human, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.