QPCT Protein, Mouse, Recombinant (His)

Name: QPCT Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-02679
Rating: 4.5 (1 reviews)

(Synonyms: Qpct, Glutaminyl-tRNA cyclotransferase, Glutaminyl-peptide cyclotransferase, Glutaminyl cyclase (QC)) Copy Product Info

Synonyms: Qpct, Glutaminyl-tRNA cyclotransferase, Glutaminyl-peptide cyclotransferase, Glutaminyl cyclase (QC)

Catalog No. TMPH-02679 Copy Product Info

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. QPCT Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 39.6 kDa and the accession number is Q9CYK2.

Pack Size	Price	USA Stock	Global Stock
5 µg	$123	20 days	20 days
10 µg	$198	20 days	20 days
20 µg	$339	20 days	20 days
50 µg	$497	20 days	20 days
100 µg	$696	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,890	20 days	20 days
1 mg	$2,970	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. QPCT Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 39.6 kDa and the accession number is Q9CYK2.
Species	Mouse
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q9CYK2
Amino Acid	AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Construction	36-362 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	Qpct, Glutaminyl-tRNA cyclotransferase, Glutaminyl-peptide cyclotransferase, Glutaminyl cyclase (QC)
Research Background	Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue.

Chemical Properties

Molecular Weight

39.6 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.