Proteoglycan 4 Protein, Human, Recombinant (His)

Name: Proteoglycan 4 Protein, Human, Recombinant (His)
Brand: TargetMol
SKU: TMPH-01973
Price: 143 USD
Availability: InStock
Rating: 5 (10 reviews)

(Synonyms: SZP, Superficial zone proteoglycan, Proteoglycan 4, PRG4, MSF, Megakaryocyte-stimulating factor, Lubricin) Copy Product Info

Synonyms: SZP, Superficial zone proteoglycan, Proteoglycan 4, PRG4, MSF, Megakaryocyte-stimulating factor, Lubricin

Catalog No. TMPH-01973 Copy Product Info

Purity: 98%

Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages. Proteoglycan 4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.8 kDa and the accession number is Q92954.

Proteoglycan 4 Protein, Human, Recombinant (His)

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	-	In Stock
10 µg	$238	20 days	20 days
20 µg	$397	-	In Stock
50 µg	$597	20 days	20 days
100 µg	$845	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:98%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages. Proteoglycan 4 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.8 kDa and the accession number is Q92954.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q92954
Amino Acid	QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
Construction	25-156 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	SZP, Superficial zone proteoglycan, Proteoglycan 4, PRG4, MSF, Megakaryocyte-stimulating factor, Lubricin
Research Background	Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.

Chemical Properties

Molecular Weight

16.8 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.