Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Proteoglycan 4 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01972

Proteoglycan 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.

Proteoglycan 4 Protein, Human, Recombinant (His & Myc)

Proteoglycan 4 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01972
Proteoglycan 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Pack SizePriceAvailabilityQuantity
20 μg $49120 days
100 μg $1,50020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Proteoglycan 4 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus.
Species
Human
Expression System
Baculovirus Insect Cells
TagN-10xHis, C-Myc
Accession NumberQ92954
Synonyms
SZP,Superficial zone proteoglycan,Proteoglycan 4,PRG4,MSF,Megakaryocyte-stimulating factor,Lubricin
Amino Acid
QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
Construction
25-156 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight18.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords