Oncostatin M/OSM Protein, Rat, Recombinant (His)

Catalog No. TMPH-03345

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Oncostatin M/OSM Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q65Z15.

Oncostatin M/OSM Protein, Rat, Recombinant (His)

Catalog No. TMPH-03345

Pack Size	Price	USA Warehouse	Global Warehouse
5 μg	$219	20 days	20 days
10 μg	$365	20 days	20 days
20 μg	$613	20 days	20 days
50 μg	$1,160	20 days	20 days
100 μg	$1,890	20 days	20 days

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. Oncostatin M/OSM Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with N-10xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is Q65Z15.
Species	Rat
Expression System	HEK293 Cells
Tag	N-10xHis
Accession Number	Q65Z15
Synonyms	OSM,Osm,Oncostatin-M
Amino Acid	KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Construction	26-208 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	24.2 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.