OmpA Protein, E. coli, Recombinant (His)

Name: OmpA Protein, E. coli, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00698
Rating: 4.5 (1 reviews)

(Synonyms: tut, tolG, Outer membrane protein II*, Outer membrane protein d, Outer membrane protein B, Outer membrane protein A, Outer membrane protein 3A, Outer membrane porin A, ompA, con) Copy Product Info

Synonyms: tut, tolG, Outer membrane protein II*, Outer membrane protein d, Outer membrane protein B, Outer membrane protein A, Outer membrane protein 3A, Outer membrane porin A, ompA, con

Catalog No. TMPH-00698 Copy Product Info

OmpA Protein, E. coli, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is P0A910.

Pack Size	Price	USA Stock	Global Stock
5 μg	$526	20 days	20 days
10 μg	$886	20 days	20 days
20 μg	$1,500	20 days	20 days
50 μg	$2,090	20 days	20 days
100 μg	$2,750	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	OmpA Protein, E. coli, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is P0A910.
Species	E. coli
Expression System	E. coli
Tag	N-10xHis
Accession Number	P0A910
Amino Acid	APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Construction	22-346 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	tut, tolG, Outer membrane protein II*, Outer membrane protein d, Outer membrane protein B, Outer membrane protein A, Outer membrane protein 3A, Outer membrane porin A, ompA, con
Research Background

Chemical Properties

Molecular Weight

38.0 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Related Tags: OmpA Protein, E. coli, Recombinant (His) chemical structure | OmpA Protein, E. coli, Recombinant (His) molecular weight