Home Tools
Log in
Cart

OmpA Protein, Borrelia burgdorferi, Recombinant (His)

Catalog No. TMPH-00211

OmpA Protein, Borrelia burgdorferi, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.9 kDa and the accession number is P0A3N6.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
OmpA Protein, Borrelia burgdorferi, Recombinant (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 341.00
100 μg 20 days $ 646.00
1 mg 20 days $ 2,760.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description OmpA Protein, Borrelia burgdorferi, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.9 kDa and the accession number is P0A3N6.
Species Borrelia burgdorferi
Expression System P. pastoris (Yeast)
Tag N-6xHis
Accession Number P0A3N6
Amino Acid CKQNVSSLDEKNSASVDLPGEMKVLVSKEKDKDGKYSLKATVDKIELKGTSDKDNGSGVLEGTKDDKSKAKLTIADDLSKTTFELFKEDGKTLVSRKVSSKDKTSTDEMFNEKGELSAKTMTRENGTKLEYTEMKSDGTGKAKEVLKNFTLEGKVANDKVTLEVKEGTVTLSKEIAKSGEVTVALNDTNTTQATKKTGAWDSKTSTLTISVNSKKTTQLVFTKQDTITVQKYDSAGTNLEGTAVEIKTLDELKNALK
Construction 17-273 aa
Protein Purity > 90% as determined by SDS-PAGE.
Molecular Weight 29.9 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

TargetMol