Shopping Cart
- Remove All
- Your shopping cart is currently empty
Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $237 | 20 days | |
100 μg | $490 | 20 days | |
1 mg | $2,080 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli. |
Species | Mouse |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P27106 |
Synonyms | Muellerian-inhibiting substance (MIS),Muellerian-inhibiting factor,Anti-Muellerian hormone (AMH),Amh |
Amino Acid | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
Construction | 450-552 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 15.4 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.