Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02787 Copy Product Info
Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02787
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$58920 days20 days
200 μg$89020 days20 days
500 μg$1,62020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP27106
Synonyms
Muellerian-inhibiting substance (MIS),Muellerian-inhibiting factor,Anti-Muellerian hormone (AMH),Amh
Amino Acid
DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Construction
450-552 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight13.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords