Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02787

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His)

Catalog No. TMPH-02787
Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.
Pack SizePriceAvailabilityQuantity
20 μg$28420 days
100 μg$58920 days
500 μg$1,62020 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.
Species
Mouse
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP27106
Synonyms
Muellerian-inhibiting substance (MIS),Muellerian-inhibiting factor,Anti-Muellerian hormone (AMH),Amh
Amino Acid
DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Construction
450-552 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight13.3 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords