Shopping Cart
- Remove All
 Your shopping cart is currently empty Your shopping cart is currently empty
Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 μg | $129 | 20 days | |
| 10 μg | $216 | 20 days | |
| 20 μg | $360 | 20 days | |
| 50 μg | $543 | 20 days | |
| 100 μg | $745 | 20 days | |
| 200 μg | $1,070 | 20 days | |
| 500 μg | $1,730 | 20 days | |
| 1 mg | $2,530 | 20 days | 
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. | 
| Description | Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity. | 
| Species | Legionella longbeachae | 
| Expression System | E. coli | 
| Tag | N-10xHis, C-Myc | 
| Accession Number | P53605 | 
| Synonyms | Rotamase,Peptidyl-prolyl cis-trans isomerase (PPIase),Outer membrane protein MIP,mip,Macrophage infectivity potentiator | 
| Amino Acid | ATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAKGMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIPGWTEALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA | 
| Construction | 21-233 aa | 
| Protein Purity | > 90% as determined by SDS-PAGE. | 
| Molecular Weight | 30.1 kDa (predicted) | 
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. | 
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. | 
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. | 
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. | 
| Research Background | Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.