MAP2K3 Protein, Human, Recombinant (MBP & His & Avi), Biotinylated

Name: MAP2K3 Protein, Human, Recombinant (MBP & His & Avi), Biotinylated
Brand: TargetMol
SKU: TMPH-04662
Rating: 4.5 (1 reviews)

(Synonyms: Stress-activated protein kinase kinase 2 (SAPK kinase 2;SAPKK-2;SAPKK2), SKK2, PRKMK3, MKK3, MEK3, MAPK/ERK kinase 3 (MEK 3), MAP2K3, MAP kinase kinase 3;MAPKK 3, Dual specificity mitogen-activated protein kinase kinase 3) Copy Product Info

Synonyms: Stress-activated protein kinase kinase 2 (SAPK kinase 2;SAPKK-2;SAPKK2), SKK2, PRKMK3, MKK3, MEK3, MAPK/ERK kinase 3 (MEK 3), MAP2K3, MAP kinase kinase 3;MAPKK 3, Dual specificity mitogen-activated protein kinase kinase 3

Catalog No. TMPH-04662 Copy Product Info

MAP2K3 Protein, Human, Recombinant (MBP & His & Avi), Biotinylated is expressed in E. coli. The accession number is P46734.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$143	20 days	20 days
10 µg	$236	20 days	20 days
20 µg	$395	20 days	20 days
50 µg	$498	20 days	20 days
100 µg	$593	20 days	20 days
200 µg	$849	20 days	20 days
500 µg	$1,370	20 days	20 days
1 mg	$1,980	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	MAP2K3 Protein, Human, Recombinant (MBP & His & Avi), Biotinylated is expressed in E. coli. The accession number is P46734.
Species	Human
Expression System	E. coli
Tag	N-MBP, C-6xHis-Avi
Accession Number	P46734
Amino Acid	MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Construction	1-347 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Stress-activated protein kinase kinase 2 (SAPK kinase 2;SAPKK-2;SAPKK2), SKK2, PRKMK3, MKK3, MEK3, MAPK/ERK kinase 3 (MEK 3), MAP2K3, MAP kinase kinase 3;MAPKK 3, Dual specificity mitogen-activated protein kinase kinase 3

Chemical Properties

Molecular Weight

87.1 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 299 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

SKK-2PRKMK-3MKK-3MEK-3

Related Tags: MAP2K3 Protein, Human, Recombinant (MBP & His & Avi), Biotinylated chemical structure | MAP2K3 Protein, Human, Recombinant (MBP & His & Avi), Biotinylated molecular weight