Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6E Protein, Mouse, Recombinant (B2M & His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02766 Copy Product Info
LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.

LY6E Protein, Mouse, Recombinant (B2M & His)

Catalog No. TMPH-02766
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.

LY6E Protein, Mouse, Recombinant (B2M & His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$10520 days20 days
10 μg$16920 days20 days
20 μg$28320 days20 days
50 μg$42820 days20 days
100 μg$59020 days20 days
200 μg$91320 days20 days
500 μg$1,62020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
Species
Mouse
Expression System
E. coli
TagN-6xHis-B2M
Accession NumberQ64253
Synonyms
Tsa-1,Thymic shared antigen 1 (TSA-1),Stem cell antigen 2,Sca-2,Lymphocyte antigen 6E,Ly-6E,Ly6e,Ly67
Amino Acid
LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Construction
27-108 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight22.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of murine coronavirus, mouse hepatitis virus, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords