LY6E Protein, Human, Recombinant (His & SUMO)

Name: LY6E Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-01619
Rating: 4.5 (1 reviews)

(Synonyms: TSA1, Thymic shared antigen 1 (TSA-1), Stem cell antigen 2 (SCA-2), SCA2, RIGE, Retinoic acid-induced gene E protein (RIG-E), Lymphocyte antigen 6E, Ly-6E, LY6E) Copy Product Info

Synonyms: TSA1, Thymic shared antigen 1 (TSA-1), Stem cell antigen 2 (SCA-2), SCA2, RIGE, Retinoic acid-induced gene E protein (RIG-E), Lymphocyte antigen 6E, Ly-6E, LY6E

Catalog No. TMPH-01619 Copy Product Info

LY6E Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 24.5 kDa and the accession number is Q16553.

Pack Size	Price	USA Stock	Global Stock
5 µg	$75	20 days	20 days
10 µg	$119	20 days	20 days
20 µg	$198	20 days	20 days
50 µg	$297	20 days	20 days
100 µg	$427	20 days	20 days
200 µg	$658	20 days	20 days
500 µg	$1,170	20 days	20 days
1 mg	$1,830	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	LY6E Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 24.5 kDa and the accession number is Q16553.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q16553
Amino Acid	LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Construction	21-101 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Synonyms	TSA1, Thymic shared antigen 1 (TSA-1), Stem cell antigen 2 (SCA-2), SCA2, RIGE, Retinoic acid-induced gene E protein (RIG-E), Lymphocyte antigen 6E, Ly-6E, LY6E
Research Background	GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.

Chemical Properties

Molecular Weight

24.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.