LAMP5 Protein, Pongo abelii, Recombinant (His & Myc)

Name: LAMP5 Protein, Pongo abelii, Recombinant (His & Myc)
Brand: TargetMol
SKU: TMPH-03146
Rating: 4.5 (1 reviews)

(Synonyms: Lysosome-associated membrane protein 5 (LAMP-5), Lysosome-associated membrane glycoprotein 5, LAMP5, Brain-associated LAMP-like protein (BAD-LAMP), Brain and dendritic cell-associated LAMP) Copy Product Info

Synonyms: Lysosome-associated membrane protein 5 (LAMP-5), Lysosome-associated membrane glycoprotein 5, LAMP5, Brain-associated LAMP-like protein (BAD-LAMP), Brain and dendritic cell-associated LAMP

Catalog No. TMPH-03146 Copy Product Info

Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain. LAMP5 Protein, Pongo abelii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 30.4 kDa and the accession number is Q5R5V2.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain. LAMP5 Protein, Pongo abelii, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 30.4 kDa and the accession number is Q5R5V2.
Species	Pongo abelii
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	Q5R5V2
Amino Acid	EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE
Construction	30-234 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Lysosome-associated membrane protein 5 (LAMP-5), Lysosome-associated membrane glycoprotein 5, LAMP5, Brain-associated LAMP-like protein (BAD-LAMP), Brain and dendritic cell-associated LAMP
Research Background	Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.

Chemical Properties

Molecular Weight

30.4 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Recombinant Proteins

Keywords

LAMP-5LAMP 5BAD-LAMPBADLAMP

Related Tags: LAMP5 Protein, Pongo abelii, Recombinant (His & Myc) chemical structure | LAMP5 Protein, Pongo abelii, Recombinant (His & Myc) molecular weight