ISG15 Protein, Bovine, Recombinant (His)

Catalog No. TMPH-00308 Copy Product Info

ISG15 Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.4 kDa and the accession number is O02741.

ISG15 Protein, Bovine, Recombinant (His)

Catalog No. TMPH-00308

Copy Product Info

ISG15 Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.4 kDa and the accession number is O02741.

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	ISG15 Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.4 kDa and the accession number is O02741.
Species	Bovine
Expression System	E. coli
Tag	N-6xHis
Accession Number	O02741
Synonyms	UCRP,Ubiquitin-like protein ISG15,Ubiquitin cross-reactive protein (BoUCRP),ISG17,ISG15,Interferon-stimulated gene product 17,G1P2
Amino Acid	MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVLQGLRAGSTVLLVVQNCISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFWLSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG
Construction	1-154 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	21.4 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Exhibits antiviral activity towards both DNA and RNA viruses. The secreted form of ISG15 can: induce natural killer cell proliferation, augment lymphokine-activated-killer (LAK) activity, induce dendritic cell maturation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL. In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy.