Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: Interleukin-12 subunit beta, IL-12B, IL12B, IL-12 subunit p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40)

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 µg | $89 | 20 days | 20 days | |
| 10 µg | $143 | 20 days | 20 days | |
| 20 µg | $237 | 20 days | 20 days | |
| 50 µg | $358 | 20 days | 20 days | |
| 100 µg | $490 | 20 days | 20 days | |
| 200 µg | $755 | 20 days | 20 days | |
| 500 µg | $1,330 | 20 days | 20 days | |
| 1 mg | $2,080 | 20 days | 20 days |
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | IL-12B Protein, Mesocricetus auratus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 39.8 kDa and the accession number is Q8CJE6. |
| Species | Mesocricetus auratus |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q8CJE6 |
| Amino Acid | IWELEKDVYVVEVDWSPDAAGERVVLTCDTSEEDDIIWTSDKNSEAVGSGKTLTIQVKEFSNAGQYTCHKGGKTLSHSRLLLHKKENGIWSTDILKDQKDPKNKTFLKCEAANYSGRFTCWWLTAISTDLKFNVKSSSSSSDSRAVTCGAASLSAEKVTVDRKDYQKYSVACQEDITCPTAEETLPIGLVMEAQHKYKYENYSTGFFIRDIIKPDPPKNLQLKPLRGSQMELSWEYPDSWSTPHSYFSLKFHVQVHRKRERKDESQFVDKTSATIRCSKGAEVRVRAQDHYYNSSWSRWVSVPCS |
| Construction | 23-327 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Interleukin-12 subunit beta, IL-12B, IL12B, IL-12 subunit p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40) |
| Research Background | Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. |
| Molecular Weight | 39.8 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.