Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

IBV (strain M41) Spike glycoprotein (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00148 Copy Product Info
IBV (strain M41) Spike glycoprotein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is P12651.

IBV (strain M41) Spike glycoprotein (His)

Catalog No. TMPH-00148
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

IBV (strain M41) Spike glycoprotein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is P12651.

IBV (strain M41) Spike glycoprotein (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$745-In Stock
200 μg$1,07020 days20 days
500 μg$1,73020 days20 days
1 mg$2,53020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Select Batch

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
IBV (strain M41) Spike glycoprotein (His) is expressed in E. coli expression system with C-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is P12651.
Species
IBV
Expression System
E. coli
TagC-6xHis
Accession NumberP12651
Synonyms
Spike glycoprotein,S glycoprotein,Peplomer protein,E2
Amino Acid
ESNFMYGSYHPSCNFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPSLCKGVYSGELDLNFECGLLVYVTKSGGSRIQTATEPPVITRHNYNNITLNTCVDYNIYGRTGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQGEYGLTYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR
Construction
317-537 aa
Protein Purity
> 90% as determined by SDS-PAGE.
IBV (strain M41) Spike glycoprotein (His)
Molecular Weight26.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
attaches the virion to the host cell membrane by interacting with sialic acids, initiating the infection.; mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.; Acts as a viral fusion peptide after S2 cleavage occurring upon virus endocytosis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords