Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) Glycoprotein U22 (His)

Name: Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) Glycoprotein U22 (His)
Brand: TargetMol
SKU: TMPH-01453
Rating: 4.5 (1 reviews)

(Synonyms: U22, Glycoprotein U22, EJLF1) Copy Product Info

Synonyms: U22, Glycoprotein U22, EJLF1

Catalog No. TMPH-01453 Copy Product Info

Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) Glycoprotein U22 (His) is expressed in in vitro E. coli expression system.

Pack Size	Price	USA Stock	Global Stock
5 μg	$526	20 days	20 days
10 μg	$886	20 days	20 days
20 μg	$1,500	20 days	20 days
50 μg	$2,090	20 days	20 days
100 μg	$2,750	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity
Description	Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) Glycoprotein U22 (His) is expressed in in vitro E. coli expression system.
Species	HHV-6A
Expression System	E. coli
Tag	N-10xHis
Accession Number	Q69557
Amino Acid	SLHIINNENSVFIATHSETELRHWLIFVKMAQRNGTAWWRMASVPINAYFERDIAFLFNPRCVIETAMGSKILCRYNKNIGVVFVDNDTKCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLSRCERFVYYCISVYLFAVVVLCSCWFALDPLFNMWA
Construction	21-202 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	U22, Glycoprotein U22, EJLF1
Research Background

Chemical Properties

Molecular Weight

24.1 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

U 22Glycoprotein U-22EJLF 1

Related Tags: Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) Glycoprotein U22 (His) chemical structure | Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) Glycoprotein U22 (His) molecular weight