HTR1D Protein, Human, Recombinant (His & KSI)

Name: HTR1D Protein, Human, Recombinant (His & KSI)
Brand: TargetMol
SKU: TMPH-00861
Rating: 4.5 (1 reviews)

(Synonyms: Serotonin receptor 1D, Serotonin 1D alpha receptor (5-HT-1D-alpha), HTRL, HTR1DA, HTR1D, 5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D) Copy Product Info

Synonyms: Serotonin receptor 1D, Serotonin 1D alpha receptor (5-HT-1D-alpha), HTRL, HTR1DA, HTR1D, 5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D

Catalog No. TMPH-00861 Copy Product Info

HTR1D Protein, Human, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 19.5 kDa and the accession number is P28221.

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$543	20 days	20 days
100 µg	$745	20 days	20 days
200 µg	$1,070	20 days	20 days
500 µg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	HTR1D Protein, Human, Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 19.5 kDa and the accession number is P28221.
Species	Human
Expression System	E. coli
Tag	N-6xHis-KSI
Accession Number	P28221
Amino Acid	MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
Construction	1-38 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Serotonin receptor 1D, Serotonin 1D alpha receptor (5-HT-1D-alpha), HTRL, HTR1DA, HTR1D, 5-hydroxytryptamine receptor 1D, 5-HT-1D, 5-HT1D
Research Background	G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.

Chemical Properties

Molecular Weight

19.5 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.