Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

HTR1D Protein, Human, Recombinant (hFc)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-00860 Copy Product Info
HTR1D Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 33.1 kDa and the accession number is P28221.

HTR1D Protein, Human, Recombinant (hFc)

Catalog No. TMPH-00860
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

HTR1D Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 33.1 kDa and the accession number is P28221.

HTR1D Protein, Human, Recombinant (hFc)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$21920 days20 days
10 μg$36520 days20 days
20 μg$61320 days20 days
50 μg$1,16020 days20 days
100 μg$1,89020 days20 days
200 μg$2,89020 days20 days
500 μg$5,16020 days20 days
1 mg$7,96020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
HTR1D Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 33.1 kDa and the accession number is P28221.
Species
Human
Expression System
HEK293 Cells
TagC-hFc
Accession NumberP28221
Synonyms
Serotonin receptor 1D,Serotonin 1D alpha receptor (5-HT-1D-alpha),HTRL,HTR1DA,HTR1D,5-hydroxytryptamine receptor 1D,5-HT-1D,5-HT1D
Amino Acid
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK
Construction
1-38 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight33.1 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.

Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords