GDNF Protein, Human, Recombinant (His & SUMO)

Name: GDNF Protein, Human, Recombinant (His & SUMO)
Brand: TargetMol
SKU: TMPH-01381
Rating: 4.5 (1 reviews)

(Synonyms: hGDNF, Glial cell line-derived neurotrophic factor, GDNF, Astrocyte-derived trophic factor (ATF)) Copy Product Info

Synonyms: hGDNF, Glial cell line-derived neurotrophic factor, GDNF, Astrocyte-derived trophic factor (ATF)

Catalog No. TMPH-01381 Copy Product Info

Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. GDNF Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 31.1 kDa and the accession number is P39905.

GDNF Protein, Human, Recombinant (His & SUMO)

Pack Size	Price	USA Stock	Global Stock
5 µg	$193	20 days	20 days
10 µg	$322	20 days	20 days
20 µg	$540	-	In Stock
50 µg	$842	20 days	20 days
100 µg	$1,180	20 days	20 days
200 µg	$1,650	20 days	20 days
500 µg	$2,600	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Purity:90%

Appearance:Lyophilized powder

Color:White

Resource Download

COA User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. GDNF Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 31.1 kDa and the accession number is P39905.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P39905
Amino Acid	SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Construction	78-211 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	hGDNF, Glial cell line-derived neurotrophic factor, GDNF, Astrocyte-derived trophic factor (ATF)
Research Background	Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.

Chemical Properties

Molecular Weight

31.1 kDa (predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.