Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Frataxin/FXN Protein, Rat, Recombinant

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03295

Frataxin/FXN Protein, Rat, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 18.6 kDa and the accession number is D3ZYW7.

Frataxin/FXN Protein, Rat, Recombinant

Frataxin/FXN Protein, Rat, Recombinant

Copy Product Info
TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-03295
Frataxin/FXN Protein, Rat, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 18.6 kDa and the accession number is D3ZYW7.
Pack SizePriceUSA WarehouseGlobal WarehouseQuantity
5 μg$15820 days20 days
10 μg$26220 days20 days
20 μg$43920 days20 days
50 μg$59820 days20 days
100 μg$75820 days20 days
200 μg$1,08020 days20 days
500 μg$1,83020 days20 days
1 mg$2,69020 days20 days
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Frataxin/FXN Protein, Rat, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 18.6 kDa and the accession number is D3ZYW7.
Species
Rat
Expression System
E. coli
TagTag Free
Accession NumberD3ZYW7
Synonyms
mitochondrial,Fxn,Frataxin, mitochondrial
Amino Acid
LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Construction
41-208 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight18.6 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.