Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Frataxin/FXN Protein, Cynomolgus, Recombinant (His)

TargetMol | SPR Buffer-Exchangeable
Catalog No. TMPH-02428 Copy Product Info
Frataxin Protein, Cynomolgus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.2 kDa and the accession number is Q8HXX9.

Frataxin/FXN Protein, Cynomolgus, Recombinant (His)

Catalog No. TMPH-02428
Copy Product Info
TargetMol | SPR Buffer-Exchangeable

Frataxin Protein, Cynomolgus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.2 kDa and the accession number is Q8HXX9.

Frataxin/FXN Protein, Cynomolgus, Recombinant (His)
Pack SizePriceUSA StockGlobal StockQuantity
5 μg$12920 days20 days
10 μg$21620 days20 days
20 μg$36020 days20 days
50 μg$54320 days20 days
100 μg$74520 days20 days
200 μg$98720 days20 days
500 μg$1,62020 days20 days
Add to Cart
Add to Quotation
For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
View More

Batch Information

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Frataxin Protein, Cynomolgus, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.2 kDa and the accession number is Q8HXX9.
Species
Cynomolgus
Expression System
E. coli
TagN-6xHis
Accession NumberQ8HXX9
Synonyms
mitochondrial,FXN,FRDA1,Frataxin, mitochondrial
Amino Acid
SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
Construction
81-210 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight18.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords