Epstein-Barr virus (strain B95-8) EBNA3 Protein (His & Myc)

Catalog No. TMPH-00537 Copy Product Info

Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.

Epstein-Barr virus (strain B95-8) EBNA3 Protein (His & Myc)

Catalog No. TMPH-00537

Copy Product Info

Epstein-Barr virus (strain B95-8) EBNA3 Protein (His & Myc)

Pack Size	Price	USA Stock	Global Stock
5 μg	$129	20 days	20 days
10 μg	$216	20 days	20 days
20 μg	$360	20 days	20 days
50 μg	$543	20 days	20 days
100 μg	$745	20 days	20 days
200 μg	$1,070	20 days	20 days
500 μg	$1,730	20 days	20 days
1 mg	$2,530	20 days	20 days

Add to Cart

Add to Quotation

For In stock only · Estimated delivery:USA Stock (1-2 days) Global Stock (5-7 days)

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Resource Download

User Guide of Recombinant Proteins

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.
Species	EBV
Expression System	E. coli
Tag	N-10xHis, C-Myc
Accession Number	P12977
Synonyms	Epstein-Barr nuclear antigen 3A (EBNA-3A;EBV nuclear antigen 3A),Epstein-Barr nuclear antigen 3,EBV nuclear antigen 3,EBNA-3,EBNA3
Amino Acid	MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA
Construction	1-138 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	22.2 kDa (predicted)
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background	Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.