Cystatin-14 Protein, Mouse, Recombinant (His)

Name: Cystatin-14 Protein, Mouse, Recombinant (His)
Brand: TargetMol
SKU: TMPH-04255
Rating: 4.5 (1 reviews)

(Synonyms: Cystatin-14, Cystatin SC, Cst14) Copy Product Info

Synonyms: Cystatin-14, Cystatin SC, Cst14

Catalog No. TMPH-04255 Copy Product Info

Cystatin-14 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q8VII3.

Customer service consultation

Pack Size	Price	USA Stock	Global Stock
5 µg	$129	20 days	20 days
10 µg	$216	20 days	20 days
20 µg	$360	20 days	20 days
50 µg	$516	20 days	20 days
100 µg	$678	20 days	20 days
200 µg	$978	20 days	20 days
500 µg	$1,590	20 days	20 days
1 mg	$2,300	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	Cystatin-14 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is Q8VII3.
Species	Mouse
Expression System	E. coli
Tag	C-6xHis
Accession Number	Q8VII3
Amino Acid	INKEFLDVTKDLDYFVASVEFAVAQFNDNNPEENTYKLLEVGRAQKKTWTMIFLMDLEMGRTICKKHDENIHNCPLLQGSREKKVHCVFQVDARPWFSHFTILTSTCVPT
Construction	21-130 aa
Protein Purity	>95% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Cystatin-14, Cystatin SC, Cst14

Chemical Properties

Molecular Weight

19.7 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.